windmaster.co.zaWindmaster Roof Ventilation, Roof Ventilation, Roof Ventilation Systems, Industrial Ventilation, In...

Domain:windmaster.co.za

Title:Windmaster Roof Ventilation, Roof Ventilation, Roof Ventilation Systems, Industrial Ventilation, In...

Keywords:industrial roof ventilation,roof ventilation systems,evaporative coolers,ventilation systems,roof ventilator,tornado turbine roof ventilation,turbine ventilator,chimney ventilation, whirly vent, whir...

Description:The Windmaster?Tornado Series of Roof Ventilation Systems are South African designed and manufactured. This cost-effective and efficient ventilation system is ideal to ventilate factories, workshops, warehouses, agricultural applications, schools, hostels, change houses, assembly halls and other bu...

Discover windmaster.co.za website stats, rating, details and status online. Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Find out where is server located. Use our online tools to find owner and admin contact info.

windmaster.co.za data is collected on the Internet. If there is a request for deletion, please send an email and we will reply to you as soon as we receive it.Contact address: huiy4nliuoutlook

Website / Domain: windmaster.co.za
Website IP Address: 41.203.16.156
Domain DNS Server: ns1.host-h.net,ns2.host-h.net,ns1.dns-h.com
Alexa Rank: 2405609
OursSite Rank: 3
Google Page Rank: 0/10 (Google Pagerank Has Been Closed)
windmaster.co.za alexa chart
Keyword Visitors
tornado extractor 23.70%
wind master 10.83%
roof extractor fans industrial 6.85%
windmaster 6.41%
turbine ventilation 6.37%
Purchase/Sale Value: $6,121
Daily Revenue: $16
Monthly Revenue: $503
Yearly Revenue: $6,121
Daily Unique Visitors: 1,543
Monthly Unique Visitors: 46,290
Yearly Unique Visitors: 563,195
StatusCode: 200
Vary: Accept-Encoding
Connection: Keep-Alive
Content-Type: text/html
Server: Apache
Date: Wed, 22 May 2019 18:29:00 GMT
Search Engines(Daily IP): 1250
Social Networks(Daily IP): 123
Ad Campaings(Daily IP): 93
Direct Traffic(Daily IP): 62
Other(Daily IP): 15
carconnectionwi.com hundredmachinery.com fortlangleyvillagefarmersmarket.org
jubbas.com vegihealth.com mapeco.com
consumerautomotiveresearch.com naturecoast.tv rollingstonesexperience.com
allofusornone.org anungbago.com toyotaoftampabay.com
surfinghollywood.com kdmc.com sjakossen.be
londontravelpass.com barcelonalowdown.com epicgreenhouses.com
hisbahouston.com nicksphoto.com growlergrlz.com
bcn.travel cityoflancasterca.org bcn-adventure.com
screenwriting.info u3awelhat.org.uk barcelonaadventure.com
new-cracked-softwares.info briarleafarm.com adampease.org

Officially Site: A Professional Query Website.

If this is your first visit here, we recommend you check out the following:

Enjoy your stay - and we hope you come back again soon!

Countable data behind any site!